General Information

  • ID:  hor003846
  • Uniprot ID:  Q9YGK4
  • Protein name:  Lipotropin gamma
  • Gene name:  pomca
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ELATNEIDYPQEEGALNQQDKKDGSYKMSHFRWSSPPAS
  • Length:  39(149-187)
  • Propeptide:  MVRGERMLCPAWLLALAVLCAAGSEVRAQCMEDARCRDLTTDENILDCIQLCRSDLTDETPVYPGESHLQPPSELEQTEVLVPLSPAALAPAEQMDPESSPQHEHKRSYSMEHFRWGKPVGRKRRPIKVYTNGVEEESTETLPAEMRRELATNEIDYPQEEGALNQQDKKDGSYKMSHFRWSSPPASKRYGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ
  • Signal peptide:  MVRGERMLCPAWLLALAVLCAAGSEVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]:
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9YGK4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003846_AF2.pdbhor003846_ESM.pdb

Physical Information

Mass: 513376 Formula: C193H289N53O67S
Absent amino acids: CV Common amino acids: S
pI: 4.45 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 8
Hydrophobicity: -135.9 Boman Index: -10965
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 37.69
Instability Index: 9355.38 Extinction Coefficient cystines: 8480
Absorbance 280nm: 223.16

Literature

  • PubMed ID:  9806347
  • Title:  Cloning and expression of two proopiomelanocortin mRNAs in the common carp (Cyprinus carpio L.).